PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC1525_p3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 213aa    MW: 22546.1 Da    PI: 9.6208
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC1525_p3genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1183.7e-372484262
      zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                ++++l+cprC+stntkfCyynny+ sqPr+fCk+CrryWt+GG+lr++PvGg +rk  k+s
  RrC1525_p3 24 QQEQLPCPRCNSTNTKFCYYNNYNFSQPRHFCKSCRRYWTHGGTLRDIPVGGVSRKTSKRS 84
                57899***************************************************98765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-33282IPR003851Zinc finger, Dof-type
PfamPF027011.2E-322682IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.6862882IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103066IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MPSDFNEARR LTTKVPQGGA VADQQEQLPC PRCNSTNTKF CYYNNYNFSQ PRHFCKSCRR  60
YWTHGGTLRD IPVGGVSRKT SKRSRAFSSS VAVGSRSFPL QATPVLLPPP SSYGGGKGNP  120
SSPYGGFTTL LSSNNVTAAS RHGPGGGFNG LEGFGLGLGH GGYFDGQGIT FWPFSTGATD  180
AAATSHAAPV VHATWQLEGL ESKVGFVAGD YLA
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00593DAPTransfer from AT5G66940Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0266402e-52AB026640.1 Arabidopsis thaliana genomic DNA, chromosome 5, TAC clone:K8A10.
GenBankAB4938172e-52AB493817.1 Arabidopsis thaliana At5g66940 gene for hypothetical protein, partial cds, clone: RAAt5g66940.
GenBankBT0295232e-52BT029523.1 Arabidopsis thaliana At5g66940 mRNA, complete cds.
GenBankCP0026882e-52CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009112344.11e-111PREDICTED: dof zinc finger protein DOF5.8
SwissprotQ9FGD66e-96DOF58_ARATH; Dof zinc finger protein DOF5.8
TrEMBLA0A078CWW61e-112A0A078CWW6_BRANA; BnaC09g07610D protein
STRINGBra037135.1-P1e-111(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22862874
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66940.13e-75Dof family protein